Protein Info for CSW01_17530 in Vibrio cholerae E7946 ATCC 55056

Annotation: anaerobic C4-dicarboxylate transporter DcuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 5 to 23 (19 residues), see Phobius details amino acids 29 to 48 (20 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 118 to 150 (33 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 244 to 261 (18 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 376 to 400 (25 residues), see Phobius details amino acids 411 to 425 (15 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details PF03606: DcuC" amino acids 6 to 455 (450 residues), 495.2 bits, see alignment E=8e-153 TIGR00771: transporter, anaerobic C4-dicarboxylate uptake C (DcuC) family" amino acids 59 to 445 (387 residues), 478.2 bits, see alignment E=1.2e-147

Best Hits

Swiss-Prot: 100% identical to DCUC_VIBCH: Probable anaerobic C4-dicarboxylate transporter DcuC (dcuC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03326, C4-dicarboxylate transporter, DcuC family (inferred from 100% identity to vcm:VCM66_A0623)

MetaCyc: 62% identical to anaerobic C4-dicarboxylate transporter DcuC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-106; TRANS-RXN-299; TRANS-RXN-300

Predicted SEED Role

"Anaerobic C4-dicarboxylate transporter DcuC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>CSW01_17530 anaerobic C4-dicarboxylate transporter DcuC (Vibrio cholerae E7946 ATCC 55056)
MEIAMLELLIGLVVTFAVGYFIVKGYKPAGILLTAGILLLILTGILGHKVLPGQMESTGN
LLTDAMEYVKYMLQNRGGGLGMQIMLLCGFASYMTHIGANNVVVKQFSKPLSFIKSPYIL
LVAAYLVACLMSLAVSSATGLGVLLMATLFPMMTAMGISRPAAVAVCASPAAIILSPTSG
DVVIAAEKSGLPLHVFAVETVLPVSICAIIVMAAAAYFWNQYLDKKDNTPMEKVDLSEME
VKSPAYYAVLPFLPIIGVFVFNGETLPGITLDIYTIVVLSIFIGVLVDYITKRFNGKQTL
EDLEACYEGMADAFKGVVMLLVAAGVFAQGLMSIGAIDNLLHLAEVAGAGGIALMLILTG
LTVAAAIATGSGNAPFYAFVELAPSLAAKMGLNPAFLIIPMLQASNLGRTISPVSGVVVA
TAGMGKISPFEVVKRTSVPVLLGLVTVIIGTMVLVPMHA