Protein Info for CSW01_17500 in Vibrio cholerae E7946 ATCC 55056

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 transmembrane" amino acids 167 to 185 (19 residues), see Phobius details amino acids 191 to 208 (18 residues), see Phobius details PF00989: PAS" amino acids 37 to 126 (90 residues), 42.1 bits, see alignment E=1.6e-14 TIGR00229: PAS domain S-box protein" amino acids 38 to 129 (92 residues), 48.9 bits, see alignment E=3.5e-17 PF13426: PAS_9" amino acids 39 to 122 (84 residues), 38.8 bits, see alignment E=1.9e-13 PF08447: PAS_3" amino acids 47 to 130 (84 residues), 57.1 bits, see alignment E=3.6e-19 PF00015: MCPsignal" amino acids 354 to 501 (148 residues), 118.1 bits, see alignment E=7.9e-38

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 99% identity to vco:VC0395_0602)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (536 amino acids)

>CSW01_17500 methyl-accepting chemotaxis protein (Vibrio cholerae E7946 ATCC 55056)
MYTFALIKITLEQQAEMSAYTPSAQQEVLVGDHDQLVSTTDLKGVITYCNDTFCRIAGFQ
ADELLGKNHNIVRHASMPKAAFADMWHHLKQGHAWRGIVKNRTKSGGFYWVDAYVTPIYQ
QGQLTGYQSVRVKAERKWVEIATKAYQALLAAEKAGKKIQFKLHTSLRYALLLGALMSPA
LAHGFQAPEQWQWLASLLPAGVLGLLFRQELVRTPQQLKQWQNEYDSISRLIYSGADAFS
VADYHLKMASARIRTILGRMMDSARPLGELANQLHLTTQEVHQALAAQNSNIQAVTQATD
AVESAAERVSSHTHSAHQLIDQVQDHCAETKHSINVTHQNLQRLATQAESAALTTLKLSD
QAQQVGQLMTEIGGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALSARTQRATQQ
IQTSIDTMLSTIEAWRGDITASRDQTEQCAQDANTTLQQLQDVECVMSDMLRVIGEVASA
AQHQRELTCEVNQHIHSIASVATQNSAATHTVEQLAMAMSGKVAEFGALSKQFAQK