Protein Info for CSW01_17485 in Vibrio cholerae E7946 ATCC 55056

Annotation: sucrose-6-phosphate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 TIGR01322: sucrose-6-phosphate hydrolase" amino acids 91 to 512 (422 residues), 447.6 bits, see alignment E=2.3e-138 PF00251: Glyco_hydro_32N" amino acids 98 to 398 (301 residues), 324.3 bits, see alignment E=9.8e-101 PF08244: Glyco_hydro_32C" amino acids 436 to 522 (87 residues), 60.3 bits, see alignment E=2.3e-20

Best Hits

Swiss-Prot: 100% identical to SCRB_VIBCH: Probable sucrose-6-phosphate hydrolase (VC_A0655) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01193, beta-fructofuranosidase [EC: 3.2.1.26] (inferred from 100% identity to vcj:VCD_000667)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>CSW01_17485 sucrose-6-phosphate hydrolase (Vibrio cholerae E7946 ATCC 55056)
MLLDTLLELAGGINNVTRILAPQGQVVLALKHPPLVPHLPDDVSLQSVLGEWQLSVQRTA
EVSDQQLAAIGKAIAERQKLETLPYQTALDCPYRPLWHISPPQGLLNDPNGFIYHQGEYH
LFYQWHPFACEHKDKYWVHLKSLDLVDWQWQSVALTPSDWFDSHGVFSGHAVSHQQDLWL
FYTGNTRLGVDRQRQTMQCAARMNANGEFEKLGPVIRCLPEGVTEHIRDPKVIYTQGKWQ
MLLGAQTLAHQGRLAVYHSDDLLHWHFDKLYGDELGDYGYMWECPDWFELQGEAFFVFGP
QGIASANPHHTIEHQNRIFRATQNAQGEIALLQGWPLDEGFDFYAPQTAQTADGRRVLCG
WMGLPDETQHPSCDQGWIHQLTALRELEWREGRIYQHPLRELDTLQSEPHTLLLSDNVTE
LKTKSFALQVTLPWGCELRLMQNTQYRVTLTLDAENQLLRLDRSATQIRQGDTIRELKLD
SPTVELRILADQSSLEIFINQGEHVMTSRIFTPRDASGISLHGASVDAKLYYMAPASAPF
NLEVNVQP