Protein Info for CSW01_17355 in Vibrio cholerae E7946 ATCC 55056

Annotation: D-3-phosphoglycerate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF00389: 2-Hacid_dh" amino acids 19 to 315 (297 residues), 70.5 bits, see alignment E=1.7e-23 PF02826: 2-Hacid_dh_C" amino acids 111 to 289 (179 residues), 158.5 bits, see alignment E=1.7e-50 PF03446: NAD_binding_2" amino acids 149 to 245 (97 residues), 22.5 bits, see alignment E=1.6e-08

Best Hits

KEGG orthology group: K00058, D-3-phosphoglycerate dehydrogenase [EC: 1.1.1.95] (inferred from 100% identity to vcm:VCM66_A0588)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>CSW01_17355 D-3-phosphoglycerate dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MKIAILDDYQNVVRGLNAFQCLQGHDVTVFNDSLSDETVLIERLKPFEALVLIRERTPIT
ENLLAHLPNLKLISQTGKVSNHIDVALCERYGVTVLEGIGSPVAPAELCWGLILAASRHL
PSYIEQLHAGHWQQNGGLGLGRTLSGHTLGIWGLGKIGQRIAQFGHVFGMPILVWGSEAS
RQKALELGYQAAADKAEFFAKADVLSLHLRLNDATRGIVTKQDLLAMKPDSLFVNTSRAE
LVESGALYSVMQTNPTRQAAVDVYENEPALPNNEPLLSLPNVLCAPHLGYVEKNSYEIYF
QAAFENVVKFAHSAAKASLSDKA