Protein Info for CSW01_17310 in Vibrio cholerae E7946 ATCC 55056

Annotation: 3-mercaptopyruvate sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 232 to 252 (21 residues), see Phobius details PF00581: Rhodanese" amino acids 7 to 125 (119 residues), 53.3 bits, see alignment E=1.6e-18 amino acids 155 to 268 (114 residues), 39.8 bits, see alignment E=2.7e-14

Best Hits

Swiss-Prot: 37% identical to THTM_SCHPO: Probable 3-mercaptopyruvate sulfurtransferase (tum1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01011, thiosulfate/3-mercaptopyruvate sulfurtransferase [EC: 2.8.1.1 2.8.1.2] (inferred from 100% identity to vch:VCA0620)

Predicted SEED Role

"Rhodanese-related sulfurtransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1 or 2.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>CSW01_17310 3-mercaptopyruvate sulfurtransferase (Vibrio cholerae E7946 ATCC 55056)
MTSPLVTAQWLQQHLHDPNLVILDSSIEFQIPTESEKDWVNKIPNAQRFDYDKVFCDPDS
PLPHMMPSEERFNTLARELGINQDSFIVVYDNSGTFASPRAWWMFKAMGHHKVYILNGGL
TEWKAQGYNVTQNYREPTPKGNFDGKLNPQAFVDASYVLKQIDNPHSQTIDARGLARFFG
EVPEPRPGVRSGHIPGSSCLPFAELITGHKLKEQAELRPLLTHMLPETAQEYLFSCGSGV
TACIVLLAAYVCGYKNLSVYDGSWTEWGQRQDLPIE