Protein Info for CSW01_17260 in Vibrio cholerae E7946 ATCC 55056

Annotation: noncanonical pyrimidine nucleotidase, YjjG family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02254: noncanonical pyrimidine nucleotidase, YjjG family
  • amino acids 3 to 222 (220 residues), 338.2 bits, E=3e-105
• PF00702: Hydrolase
  • amino acids 3 to 189 (187 residues), 98.7 bits, E=9.1e-32
• PF13419: HAD_2
  • amino acids 6 to 194 (189 residues), 72 bits, E=1.1e-23
• TIGR01509: HAD hydrolase, family IA, variant 3
  • amino acids 95 to 195 (101 residues), 30.8 bits, E=4.4e-11
• TIGR01549: HAD hydrolase, family IA, variant 1
  • amino acids 97 to 189 (93 residues), 60.1 bits, E=5e-20
• PF13242: Hydrolase_like
  • amino acids 149 to 215 (67 residues), 42.3 bits, E=8.5e-15

Best Hits

Swiss-Prot: 62% identical to YJJG_ECO57: Pyrimidine 5'-nucleotidase YjjG (yjjG) from Escherichia coli O157:H7

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to vcj:VCD_000711)

MetaCyc: 62% identical to pyrimidine 5'-nucleotidase YjjG (Escherichia coli K-12 substr. MG1655)
3.1.3.M8 [EC: 3.1.3.M8]; 5'-nucleotidase. [EC: 3.1.3.M8, 3.1.3.5]

Predicted SEED Role

"5'-nucleotidase YjjG (EC 3.1.3.5)" (EC 3.1.3.5)

MetaCyc Pathways

• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation II (3/5 steps found)
• guanosine nucleotides degradation III (2/4 steps found)
• guanosine nucleotides degradation I (1/4 steps found)
• guanosine nucleotides degradation II (1/4 steps found)
• ureide biosynthesis (3/7 steps found)
• adenosine nucleotides degradation I (3/8 steps found)
• NAD salvage (plants) (5/11 steps found)
• superpathway of guanosine nucleotides degradation (plants) (1/6 steps found)
• tunicamycin biosynthesis (2/9 steps found)
• purine nucleotides degradation I (plants) (4/12 steps found)
• superpathway of purines degradation in plants (4/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.M8

Protein Sequence (224 amino acids)

>CSW01_17260 noncanonical pyrimidine nucleotidase, YjjG family (Vibrio cholerae E7946 ATCC 55056)
MKYDWILFDADETLFHFDAFKGMQLMFARKGVEFTEQDFHQYQEVNKPLWVDYQNGDITA
AQLKHTRFAGWAEKLNTTTDELNSAFLQAMADICTLLPGAMELMQALQGKARLGIITNGF
TELQDVRLAKTGMTDFFDQIVISEEVGIAKPDAGIFAHALERMGNPTKSRVLMVGDNPHS
DILGGLNFGIETCWLNVHQHPKPDGITPHYEVTSLHELREILLA