Protein Info for CSW01_17125 in Vibrio cholerae E7946 ATCC 55056

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00369: uncharacterized domain 1
  • amino acids 32 to 147 (116 residues), 121.2 bits, E=1.2e-39
• PF03061: 4HBT
  • amino acids 63 to 139 (77 residues), 63.2 bits, E=1.2e-21

Best Hits

Swiss-Prot: 100% identical to Y3380_VIBCH: Putative esterase VC_A0580 (VC_A0580) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_A0539)

MetaCyc: 53% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]

Predicted SEED Role

"Uncharacterized protein"

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.28

Use Curated BLAST to search for 3.1.2.28

Protein Sequence (161 amino acids)

>CSW01_17125 esterase (Vibrio cholerae E7946 ATCC 55056)
MSHFYSFRTQAMSIWNKPISLEILNATSKNTLIEHLNIIYTEVTENSISATMPVCHFTHQ
PLGMLHGGASVVLAETLGSVAANFSVGEDAYCVGLDINANHVRAMREGLVTGTAVPLHIG
VSTQVWQIEIKDEQGRLVCISRLTVAVKRSRPNQAKPVAEV