Protein Info for CSW01_17050 in Vibrio cholerae E7946 ATCC 55056

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 262 to 282 (21 residues), see Phobius details PF11884: DUF3404" amino acids 33 to 290 (258 residues), 407.7 bits, see alignment E=2.6e-126 PF00512: HisKA" amino acids 295 to 351 (57 residues), 30.8 bits, see alignment 3.8e-11 PF02518: HATPase_c" amino acids 401 to 492 (92 residues), 42.9 bits, see alignment E=9.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_A0524)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>CSW01_17050 histidine kinase (Vibrio cholerae E7946 ATCC 55056)
MRYSFCMLEKTNIPLIRALNLTLVSLCFAMLPNPVHADSLPERIDLFVSLFDYNSATTSY
DIRSIQTDFPTRLLTPDSMLPQTSEYPLKDIQLLYKLAQSCTGKLPLSPLITEPLVFTRS
LCKGSSLSPRWFARSGLIHPGGGTYAFRYAEKYPAQFANLLPYMHIQERPNAAEGTLLYH
LQNMGEDAINALVSGASMFGSGSDLWLRKGDIYYLFNEETWLTNANKAGLSYSLLSADNT
CFIQRGNICWDVEDHSDLLRTSMIILVIANIFLVLGWSGYRWNSKRQEMRSRMLILQILT
HELRTPIASLSLTVEGFRREFEHLPESLYDEFRRLCEDSRRLRQLAEASKDYLQSDSKPL
ASDWVPSVEEWLQYKVEEEFSGNVTLKLNQDIAAKLNVYWLGTCVDNLLRNAVKYGVAPV
TLEVITQTNLVTFKVTDQGSLTHRDWRHLRKPFVSKSGLGLGLTIVESMVGRMGGKMSLE
GPPTTFILEIPCETDTASR