Protein Info for CSW01_16930 in Vibrio cholerae E7946 ATCC 55056

Annotation: YceI family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04264: YceI" amino acids 25 to 184 (160 residues), 145.7 bits, see alignment E=7.1e-47

Best Hits

Swiss-Prot: 100% identical to Y3339_VIBCH: UPF0312 protein VC_A0539 (VC_A0539) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 99% identity to vco:VC0395_0473)

Predicted SEED Role

"FIG01201176: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (189 amino acids)

>CSW01_16930 YceI family protein (Vibrio cholerae E7946 ATCC 55056)
MKKTLMAVGLAAVMSIPFAANAADYVIDTKGAHASINFKVNHLGYSYIKGRFNKFDGEFS
YDPANIAASSVVVNVDTRSLDSNHAERDKHIRSADFIDASKYSTATFKSTEVVDKGNGQL
EVKGDLTLHGQTKPIVINAEFIGAGQDPWGGQRSGFAGTTRLELKDFGIQVMGASSYVDM
ELHVEGVQK