Protein Info for CSW01_16925 in Vibrio cholerae E7946 ATCC 55056

Annotation: cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 8 to 178 (171 residues), 112.1 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 99% identity to vco:VC0395_0472)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>CSW01_16925 cytochrome b (Vibrio cholerae E7946 ATCC 55056)
MKNSDSQHYNLVTRSIHWISALVVIGMFAVGTWMMDLSYYSEWYRTAPHWHKSVGLLLAG
LTLFRLIWKALSSSPKIEGARWEIVAAKSAHHLMYVGLFVLFVSGYLISTEDGRGIEVFN
WFTVPGAGALFENQADIAGNIHFYTAWGLIILAGLHAVAALKHHFINRDNTLRKMLTGAS
K