Protein Info for CSW01_16855 in Vibrio cholerae E7946 ATCC 55056

Annotation: CAI-1 autoinducer synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00155: Aminotran_1_2
  • amino acids 40 to 375 (336 residues), 104 bits, E=5.2e-34

Best Hits

Swiss-Prot: 100% identical to CQSA_VIBCH: CAI-1 autoinducer synthase (cqsA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K10915, CAI-1 autoinducer synthase [EC: 2.3.-.-] (inferred from 100% identity to vcm:VCM66_A0482)

MetaCyc: 100% identical to 3-aminotridec-2-en-4-one synthase (Vibrio cholerae O1 biovar El Tor str. N16961)
2.3.1.-; 2.3.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

• autoinducer CAI-1 biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Puromycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.-.-

Protein Sequence (389 amino acids)

>CSW01_16855 CAI-1 autoinducer synthase (Vibrio cholerae E7946 ATCC 55056)
MNKPQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKA
RLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTIC
QPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLG
TIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAY
RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKL
RIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLS
LNSDVNDEQIAKIIEVCSDAVNYGDFYFR