Protein Info for CSW01_16605 in Vibrio cholerae E7946 ATCC 55056

Annotation: VOC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF00903: Glyoxalase" amino acids 9 to 128 (120 residues), 65.6 bits, see alignment E=2.8e-22

Best Hits

Swiss-Prot: 62% identical to Y3691_SHEFN: Uncharacterized protein Sfri_3691 (Sfri_3691) from Shewanella frigidimarina (strain NCIMB 400)

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_000863)

Predicted SEED Role

"Glyoxalase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>CSW01_16605 VOC family protein (Vibrio cholerae E7946 ATCC 55056)
MSKVVQQQIGNIALVVENYDDAIEFYTKKLQFSLVEDTDLGGGKRWVQVSPPNSNGTNLL
LAQASTEEQAQFVGNQTGGRVFLFLQTNDFWRDYELMKANGVVFNEEPRVEEYGTVVVFQ
DLYGNKWDLLQLNKAHK