Protein Info for CSW01_16580 in Vibrio cholerae E7946 ATCC 55056

Annotation: IS5 family transposase ISVch5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF05598: DUF772" amino acids 17 to 110 (94 residues), 91.3 bits, see alignment E=4.6e-30 PF01609: DDE_Tnp_1" amino acids 137 to 312 (176 residues), 112.8 bits, see alignment E=1.8e-36

Best Hits

Swiss-Prot: 82% identical to INSH6_ECOLI: Transposase InsH for insertion sequence element IS5H (insH6) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_0947)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>CSW01_16580 IS5 family transposase ISVch5 (Vibrio cholerae E7946 ATCC 55056)
MSHQLTFADGEFSNKRRQTRKELFLARMEKLLPWSQLLAVIEPFYPKAGNGRRPYPLETM
FRIHCMQQWYSLSDEAMEDALYEIASMRLFAHLSLDRAIPDRTTIMNFRHLLEQHQLGRS
VFEPINQWLSERGVLMKQGTLVDATIIEAPSSTKNKTNQRDPEMHQTKKGNEWHFGMKAH
IGVDAKSGLTHTLVTTAANEHDLNQLSNLLHGDEEFVSGDAGYQGAHKRDELKGADVDWL
IAERPGKVRALKKHPRKNKVAIHIEYLKASIRAKVEHPFRIIKCQFGFIKARYKGLMKND
NQLAMLFTLANLVKVDQLIRRQARSA