Protein Info for CSW01_16010 in Vibrio cholerae E7946 ATCC 55056

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF13420: Acetyltransf_4" amino acids 9 to 158 (150 residues), 60.3 bits, see alignment E=5.8e-20 PF13302: Acetyltransf_3" amino acids 16 to 138 (123 residues), 33.5 bits, see alignment E=1.6e-11 PF00583: Acetyltransf_1" amino acids 29 to 137 (109 residues), 56.8 bits, see alignment E=6.8e-19 PF13508: Acetyltransf_7" amino acids 52 to 139 (88 residues), 29.8 bits, see alignment E=1.6e-10 PF08445: FR47" amino acids 85 to 140 (56 residues), 26.7 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 99% identity to vco:VC0395_0935)

Predicted SEED Role

"toxin resistance protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>CSW01_16010 N-acetyltransferase (Vibrio cholerae E7946 ATCC 55056)
MEIXTGEFEDIAGITDIFNFYIEQTNARFEEFPFTLENREEWFSQFSRTAKYQIYVAVEN
GVLQGFACSQKYRAIPAFDDTVEVSVYLAQEAKGKGLGSKLYTQLFSSIRAYGVHRILSG
VALPNDASVALHKRFGFREVGISNEYAKKHGQYISSLWLEKALNVESAL