Protein Info for CSW01_15470 in Vibrio cholerae E7946 ATCC 55056

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00106: adh_short" amino acids 5 to 199 (195 residues), 178.5 bits, see alignment E=1.6e-56 PF08659: KR" amino acids 7 to 171 (165 residues), 52.3 bits, see alignment E=1e-17 PF13561: adh_short_C2" amino acids 14 to 250 (237 residues), 179.9 bits, see alignment E=9.3e-57

Best Hits

Swiss-Prot: 62% identical to YGFF_ECOLI: Uncharacterized oxidoreductase YgfF (ygfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_000979)

Predicted SEED Role

"3-hydroxyacyl-CoA dehydrogenase [isoleucine degradation] (EC 1.1.1.35)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module (EC 1.1.1.35)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.35

Use Curated BLAST to search for 1.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>CSW01_15470 NAD(P)-dependent oxidoreductase (Vibrio cholerae E7946 ATCC 55056)
MSVQKVVVITGGSRGIGAATAKLFAQNGFSVCINYKSNAEAANTLVEEIKALGGHCIAVQ
ADVSKESDVVKLFETVDQELGVVSVLVNNAGILKKQMRLDEMSAERINSILINNVTGYFL
CCRETVKRMSTRHGGFGGVIVNVSSGAARTGSPNEYIDYAASKGAIDTLTKGLSLEVAAE
GIRVNCVRPGLIYTDMHADGGEPDRIERLKNKIPMQRGGLPDEVAEAIYWLSSEKSSFST
GNFLDLAGGL