Protein Info for CSW01_15405 in Vibrio cholerae E7946 ATCC 55056

Annotation: integron integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR02249: integron integrase" amino acids 5 to 320 (316 residues), 524 bits, see alignment E=7.1e-162 PF13495: Phage_int_SAM_4" amino acids 6 to 87 (82 residues), 103.8 bits, see alignment E=5.3e-34 PF00589: Phage_integrase" amino acids 105 to 307 (203 residues), 143.6 bits, see alignment E=5.6e-46

Best Hits

Swiss-Prot: 46% identical to INT2_ECOLX: Integrase/recombinase (int) from Escherichia coli

KEGG orthology group: None (inferred from 100% identity to vch:VCA0291)

Predicted SEED Role

"Integron integrase IntI4" in subsystem Integrons

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>CSW01_15405 integron integrase (Vibrio cholerae E7946 ATCC 55056)
MKSQFLLSVREFMQTRYYAKKTIEAYLHWITRYIHFHNKKHPSLMGDKEVEEFLTYLAVQ
GKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLERKLPVVLTRDEIRRLLEIVDP
KHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGKGGKNRTVTLAKELYPHLKEQ
IALAKRYYDRDLHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRH
HMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQ
IYTHVLDRGASGVLSPLSRL