Protein Info for CSW01_15390 in Vibrio cholerae E7946 ATCC 55056

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 TIGR00168: translation initiation factor IF-3" amino acids 19 to 183 (165 residues), 236.8 bits, see alignment E=5.1e-75 PF05198: IF3_N" amino acids 19 to 88 (70 residues), 104.2 bits, see alignment E=3.3e-34 PF00707: IF3_C" amino acids 95 to 181 (87 residues), 115.7 bits, see alignment E=7.5e-38

Best Hits

Swiss-Prot: 100% identical to IF3_VIBCH: Translation initiation factor IF-3 (infC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 84% identity to vsa:VSAL_I1759)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>CSW01_15390 translation initiation factor IF-3 (Vibrio cholerae E7946 ATCC 55056)
MKGGRRGQVPVKQNQHRLNGEIRGVREVRLTGADGESVGIVSIQEALATAEESGLDLVEI
SPNAEPPVCRVMDYGKFLFEKSKATKEQKKKQKQIQIKELKFRPGTDVGDYQVKLRNLIR
FLEEGNKVKVTIRFRGREMAHQDIGVDVLNRLKEDTDEFAVVESFPTKIEARQMIMVLAP
KKK