Protein Info for CSW01_15195 in Vibrio cholerae E7946 ATCC 55056

Annotation: PTS ascorbate-specific transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF00359: PTS_EIIA_2" amino acids 7 to 152 (146 residues), 118.5 bits, see alignment E=1.2e-38

Best Hits

Swiss-Prot: 50% identical to ULAC_SALCH: Ascorbate-specific PTS system EIIA component (ulaC) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K02821, PTS system, ascorbate-specific IIA component [EC: 2.7.1.69] (inferred from 100% identity to vch:VCA0245)

MetaCyc: 48% identical to L-ascorbate specific PTS enzyme IIA component (Escherichia coli K-12 substr. MG1655)
RXN0-2461 [EC: 2.7.1.194]

Predicted SEED Role

"Ascorbate-specific PTS system, EIIA component (EC 2.7.1.-)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.69

Use Curated BLAST to search for 2.7.1.- or 2.7.1.194 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>CSW01_15195 PTS ascorbate-specific transporter subunit IIA (Vibrio cholerae E7946 ATCC 55056)
MGLKQSLIENNSIQLQAKANNWREAIKIGTDMLIASGAITPAYHEAIIASVEQLGPYICI
APNLALPHARPENGVLRTAFALVTLQEPIYFEGEDEPVDVLITLAGSSSDEHMEGLMEVT
QVLDDENSATGVDLDKLRRCRDKQQVYAVIDQALSQQASAQQELAHIA