Protein Info for CSW01_15120 in Vibrio cholerae E7946 ATCC 55056

Annotation: iron(III) ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 177 to 194 (18 residues), see Phobius details amino acids 224 to 248 (25 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details PF01032: FecCD" amino acids 16 to 312 (297 residues), 176.4 bits, see alignment E=3.7e-56

Best Hits

Swiss-Prot: 47% identical to YCLO_BACSU: Petrobactin import system permease protein YclO (yclO) from Bacillus subtilis (strain 168)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to vco:VC0395_0999)

Predicted SEED Role

"Ferric vibriobactin, enterobactin transport system, permease protein VctG (TC 3.A.1.14.6)" in subsystem Iron acquisition in Vibrio (TC 3.A.1.14.6)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>CSW01_15120 iron(III) ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MQDRTKLLLLIAISLLFAALFIGVGLNADNYQYFLSRRVPKVLAMVFAGIAIAQSSLAFQ
TITHNRILTPSIMGFDALYMFTQVLVVVLFGGMSSIAMNVYWNFSLSVAAMLSFSTLLFT
FYFRSGHRNLIVLLLLGVILGQLFSSIASFFVMLMDPNDFASVQANMFASFNNVNTKLVY
VVSPLLLLACVLLFRQHRVLDVFWLDKDNAVSLGVDVHKVTRNVLLISALLISISTALVG
PILFFGLLVTNLTREWFRSYRHSTLLLATSAMSVCALLSGQWIIEKVFHFGTTLSVVINF
IGGIYFLSLLLRNKVV