Protein Info for CSW01_15110 in Vibrio cholerae E7946 ATCC 55056

Annotation: iron(III) ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 51 (51 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 83 to 305 (223 residues), 89.9 bits, see alignment E=8.6e-30

Best Hits

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 100% identity to vch:VCA0227)

Predicted SEED Role

"Ferric vibriobactin, enterobactin transport system, substrate-binding protein VctP (TC 3.A.1.14.6)" in subsystem Iron acquisition in Vibrio (TC 3.A.1.14.6)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>CSW01_15110 iron(III) ABC transporter substrate-binding protein (Vibrio cholerae E7946 ATCC 55056)
MVLIIVRTLLMRISIKMIPLAYLNHFRKEHMKSRIHWAALGLLAAFAAQAETVTIEHRLG
KTTLEQKPQRVVVIGVGALDAIDSFGIEPVAVSKFDGTPDYLAKYKSDKYPSAGSLFEPD
FETIYTQKPDLIVIGPRASKSYDELSKIAPTIVFAAEADQGYWESTQQQWRNLGKVFAIE
PAVEAKIEQVDAQFKSIMQYNQQHKSDAMLVMSSGGNLTTFGANSRFSSVYKDFGFSETV
PVSKESSHGDLISFEYIREHNPKTLLVVDRDKVVTKGETNIRQTFENDLVKATTAYKNGH
IAYLDVNAWYIAISGVKATEQMVADMKASVGMQ