Protein Info for CSW01_15080 in Vibrio cholerae E7946 ATCC 55056

Annotation: methyl-accepting chemotaxis protein HlyB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 199 to 220 (22 residues), see Phobius details PF02203: TarH" amino acids 3 to 172 (170 residues), 37.4 bits, see alignment E=5.1e-13 PF12729: 4HB_MCP_1" amino acids 12 to 189 (178 residues), 54.3 bits, see alignment E=2.5e-18 PF00672: HAMP" amino acids 219 to 267 (49 residues), 25.5 bits, see alignment 2.7e-09 PF00015: MCPsignal" amino acids 331 to 515 (185 residues), 137.7 bits, see alignment E=7.4e-44

Best Hits

Swiss-Prot: 100% identical to HLYB_VIBCH: Methyl-accepting chemotaxis protein HlyB (hlyB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_1007)

Predicted SEED Role

"Methyl-accepting chemotaxis protein, hemolysin secretion protein HylB" in subsystem Cytolysin and Lipase operon in Vibrio

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>CSW01_15080 methyl-accepting chemotaxis protein HlyB (Vibrio cholerae E7946 ATCC 55056)
MIINKFSLKWMLAIAVAIPAIALLFVAFTSLNTMSVMQAQSNSLYANTAAPMRAMAEATS
RIPRMRVGIDMMLLQETALKDAKGVLKRVEEARTEDIPEMRQAMQVAVDSQVNPELKEQA
RKLQARFEQMVREELEPMLQAFANNDMTTAQNIYRDKYAPTYGEMRKQANQILDTLLQQA
EQQNHASVESFEAGRTKQMVIIAAGLIISFITSLVIITNLRSRVAYLKDRMSSAAANLSL
RTRLELDGNDELCDIGKSFNAFIDKVHHSIEEVAENSKELATMASSVSQRAHMTQSNCAS
QRDRTVQVATAIHELGATVSEIASNAAMAADVAKQATLHSGEGKKVVGEVQNRIQTLVNE
LDNATQVVSSLATQINGISSTLDTIRSISEQTNLLALNAAIEAARAGEQGRGFAVVADEV
RTLASRSAASTEEIQQVINRLQTESTRAVEAMEKGRSQSDVVVEFSAKANQSLTEINSQI
DQINDQNIQVATATEEQSTVVEDINRNVEDINQLTTETSHVADELSRASASLQRLSSQLD
KLVGSFEL