Protein Info for CSW01_14945 in Vibrio cholerae E7946 ATCC 55056

Annotation: 2-hydroxyacid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF00389: 2-Hacid_dh" amino acids 5 to 328 (324 residues), 118.9 bits, see alignment E=1.9e-38 PF02826: 2-Hacid_dh_C" amino acids 111 to 298 (188 residues), 168.1 bits, see alignment E=1.9e-53

Best Hits

Swiss-Prot: 64% identical to LDHD_ECOLI: D-lactate dehydrogenase (ldhA) from Escherichia coli (strain K12)

KEGG orthology group: K03778, D-lactate dehydrogenase [EC: 1.1.1.28] (inferred from 100% identity to vcm:VCM66_A0188)

MetaCyc: 64% identical to D-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
D-lactate dehydrogenase. [EC: 1.1.1.28]

Predicted SEED Role

"D-lactate dehydrogenase (EC 1.1.1.28)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>CSW01_14945 2-hydroxyacid dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MLNVIFFSAKHYDIASFSKLVDPTQLSLHFHDFRLTDKTAQMAKGCEVVCAFVNDELHAS
VLEQLYQGGTRLIAMRCAGFDKVDLEAAKRLGMQVVRVPAYSPEAVAEHTVGMMLCLNRR
FHKAYQRTRDANFSLDGLVGFNFHGKTVGVIGSGKIGVATMRILQGLGMQILCFDPYPNP
DAIALGARYVELSELFAQSDVITLHCPMSKENYHLLNESAFDQMKDGVMIINTSRGELLD
SVAAIEALKRGRIGALGLDVYDNEKDLFFQDKSNDVIVDDVFRRLSACHNVLFTGHQAFL
TEDALNNIAQTTLNNIQLFFDNQASGNELIQ