Protein Info for CSW01_14885 in Vibrio cholerae E7946 ATCC 55056

Annotation: NupC/NupG family nucleoside CNT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 341 to 367 (27 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details TIGR00804: nucleoside transporter, NupC family" amino acids 4 to 399 (396 residues), 454.9 bits, see alignment E=1.4e-140 PF01773: Nucleos_tra2_N" amino acids 8 to 81 (74 residues), 86.5 bits, see alignment E=2.1e-28 PF07670: Gate" amino acids 90 to 186 (97 residues), 65.8 bits, see alignment E=6.4e-22 PF07662: Nucleos_tra2_C" amino acids 192 to 397 (206 residues), 251.6 bits, see alignment E=9.5e-79

Best Hits

Swiss-Prot: 53% identical to Y519_HAEIN: Uncharacterized transporter HI_0519 (HI_0519) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03317, concentrative nucleoside transporter, CNT family (inferred from 100% identity to vco:VC0395_1098)

MetaCyc: 45% identical to purine nucleobase/nucleoside transporter (Helicobacter pylori 26695)
TRANS-RXN-195; TRANS-RXN-495

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>CSW01_14885 NupC/NupG family nucleoside CNT transporter (Vibrio cholerae E7946 ATCC 55056)
MAILFGIIGVTVLILCAYLLSESRSAINWKTISRALLLQIGFAALVLYFPLGQTALSSLS
NGVSGLLGFADVGIRFLFGDLADTGFIFAVRVLPIIIFFSALISALYYLGVMQKVIALIG
GGIQRFLGTSKAESLVATGNIFLSQGESPLLVRPFLANMTRSELFAVMAGGMASVAGSVL
GGYAGLGVELKYLIAASFMAAPGSLMMAKIIVPERGVPIDQSQVELDKAQDSNLIDALAS
GAMNGMKVAVAVGTMLIAFVSVIAMVNTGLENLGDLVGFSGITLQAMFGYLFAPLAWVIG
IPSHEVLAAGSYIGQKVVMNEFVAFIDFVEHKALLSEHSQVIITFALCGFANIGSIAIQL
GSIGVIAPERRSEVANLGIKAVIAGTLANLMSACLAGIFISL