Protein Info for CSW01_14845 in Vibrio cholerae E7946 ATCC 55056

Annotation: VWA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 302 to 331 (30 residues), see Phobius details signal peptide" amino acids 25 to 27 (3 residues), see Phobius details PF13519: VWA_2" amino acids 88 to 193 (106 residues), 60.6 bits, see alignment E=2.1e-20 PF07719: TPR_2" amino acids 400 to 430 (31 residues), 24.4 bits, see alignment (E = 2.1e-09)

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 98% identity to vco:VC0395_1107)

Predicted SEED Role

"TPR domain protein in aerotolerance operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (646 amino acids)

>CSW01_14845 VWA domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MSSLIFLYPHWLGLLVPLLLLAAWRGLRQNQRGLIAPHLAQALGIETRTRRSFGGVLALS
WIVATLAMAGPSWQSAERPSVQNSAARVLIMDMSRSMYATDLAPNRLTQARYKALDLLKG
WQEGSTGLVAYAADAYVVSPLTSDSATLANLLPNLSPDIMPYQGSDAAAAVSLAITMLQQ
SGHQQGDLILITDDMSVTEREKLISLLQGSPWRLVTLAIGTPSGAPIPLGDGSLLKDRQG
QTVIAKTAFDQLQQLSQSVQGVLTAYRADGADVAHILSLTQQPIDIAESTSRQAITERVN
NGYWLVLPLLIAALCLFRRGVIFSLLLLFGVSLPNQQAWASAWLNQDQQAMRMFNNEQYA
QAAEAFRDPRWQGAARYYAKDYQGAIDAYSQIANPDTATQYNLANAYAQAGELQKAQDLY
EHVLKQEPNHQDARHNLDVVKAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQDSSSGASGQEAQEDSSANPSNTAQEQEASSQTKGASTPDPQQDLQESTEPK
ANAKPQEQPNAVDDAQAGEPSAHREQSKDSQNGQPSGTEQNDEQSDKANAAQPSTSVTTS
SDPNLDPMLRKLEQVESARDPSALLRAQFILQAQRKPQPTEPDQPW