Protein Info for CSW01_14755 in Vibrio cholerae E7946 ATCC 55056

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 45 to 66 (22 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details PF01794: Ferric_reduct" amino acids 50 to 186 (137 residues), 65.3 bits, see alignment E=5.6e-22 PF08022: FAD_binding_8" amino acids 244 to 321 (78 residues), 33.8 bits, see alignment E=3.1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to vch:VCA0151)

Predicted SEED Role

"Predicted ferric reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>CSW01_14755 oxidoreductase (Vibrio cholerae E7946 ATCC 55056)
MIKWNWVMSRVKYTLWVVVGIVTLLWVQAEPTLFGSTNLFQWRSGLVQFSGILALMLMSL
AMLLALRLPLIEQWTQGIDKGYRIHKWLGISALLLGIFHWLAYHLPKWLISLELLTKPAR
LNGSGPNSNLSGLALWLKEAKPLAMEIGEWGFYALIVLLVVSLWSAIKYKPFRLTHRLMA
VVYLLIALHSVILLKKAYWGEPIYWLTMLFIVVGSWAACYSLLGLVGRQSRYPAHVKAFH
YCPNSQTLDLTIQLDKPWLGHKAGQFAYLKFAGEEPHPFTIACAHQGSQLRFLIKELGDF
TTGLHQRLQNGKSLEVEGPYGKFDFSTQQPQIWIGGGVGIAPFMAGLDWLMRERAHPPVH
LFFCCHQIDPDLCAELRHKAQLAGVSLTIIDSSVDPHLSADDIARRCGDLSRFEIYFCGP
IAFSNSLKKALKPYQVDLSRQFHEEQFVMR