Protein Info for CSW01_14650 in Vibrio cholerae E7946 ATCC 55056

Annotation: ribose import ATP-binding protein RbsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 PF00005: ABC_tran" amino acids 21 to 170 (150 residues), 122.1 bits, see alignment E=4.1e-39 amino acids 270 to 423 (154 residues), 87.6 bits, see alignment E=1.8e-28

Best Hits

Swiss-Prot: 100% identical to RBSA_VIBCH: Ribose import ATP-binding protein RbsA (rbsA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to vcm:VCM66_A0126)

MetaCyc: 73% identical to ribose ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>CSW01_14650 ribose import ATP-binding protein RbsA (Vibrio cholerae E7946 ATCC 55056)
MTQAILALSQIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKSTLMKVLTGIYSKDAG
SIEYQGQPVSFKGPRDSQLAGISIIHQELNLIPQLTIAENIFLGREMTSPFGRILWDEMH
RKADQLLARLNVKHSAKTLLGELSLGEQQMVEIAKALSFESKVIIMDEPTDALTDTETES
LFNVINELREQGCGIVYISHRLKEIFEICDDITVLRDGKFIGECRVCDTNEDGLIEMMVG
RKLEEQYPRIAAQQGDISLEVIGLTGSGVHDVSFTLKKGEILGVSGLMGAGRTELMKVIY
GALPSERGVINLNGRTVNPVSPQDGLANGIAYISEDRKGDGLVLGLSVKENMSLCALDQL
SKGVQIRHADEVIAVDDFIRLFNIKTPSREQIIGNLSGGNQQKVAIAKGLMTKPKVLILD
EPTRGVDVGAKKEIYQLINQFKAEGMSIILVSSEMPEVLGMSDRILVMHEGRISGEFMAS
EADQEKLMACAVGRNPAHAA