Protein Info for CSW01_14530 in Vibrio cholerae E7946 ATCC 55056

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 332 to 349 (18 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 387 to 418 (32 residues), see Phobius details amino acids 489 to 507 (19 residues), see Phobius details PF00916: Sulfate_transp" amino acids 27 to 393 (367 residues), 285.3 bits, see alignment E=6.3e-89 PF01740: STAS" amino acids 449 to 540 (92 residues), 48.9 bits, see alignment E=4.9e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_000141)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (592 amino acids)

>CSW01_14530 SulP family inorganic anion transporter (Vibrio cholerae E7946 ATCC 55056)
MNEVKAVWIRQWFPGLYQFKDYQRGWLTDDVRAAFSVVAVALPVAIAYAQLTGVPAIVGL
YSCVLPMLVYALMGTSRQLIVGPDAATCAVIAAVVTPLAAGDTTKHWQLVMTMTAMTGFW
CILASRLKLGIFADFLSRPILLGLLNGVALTIIVGQFAKVLGLKYEKRYLLERIVEAPEL
LYSLHWQTLGLSALTLAIYLVIKRWQPRWPAAMFAIMVAALLVWALNLESVGVQVVGVIQ
GGLPEFQAPAFDLGISRELVMPALNLAMVSFVSMMLTARSFAAKNGYDIDADKEFRALGV
ANVAAAFSQGFAISGADSRTAVNDANGGKSQLVSVIAALFIALVAVFAYQPLQFIPVAAL
GVVLIIASLSLLDLKGVWNLRKRDKDAFYLALITFIAVLVIGVIPGITLAVLLGLFQFLK
LVMRPTDQMMGLDEEGTLRTLDGSEKAKPIPGMVIFRFNSPLTYFNAPYFKRRILDQTER
EGAQVGCVIIDAVASFTHLDLSVMAMLADLHGILKKRGIRLILAGRKRSLRHWCDLTGIN
TAEGGIVLRADMYLAIKLSGCYLSAMEEGHVPVVQKEPDISVLLKPTTTEVA