Protein Info for CSW01_14440 in Vibrio cholerae E7946 ATCC 55056

Annotation: redox-sensitive transcriptional activator SoxR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 TIGR01950: redox-sensitive transcriptional activator SoxR" amino acids 2 to 142 (141 residues), 251.1 bits, see alignment E=1.2e-79 PF13411: MerR_1" amino acids 3 to 70 (68 residues), 61.7 bits, see alignment E=8.7e-21 PF00376: MerR" amino acids 4 to 40 (37 residues), 49.4 bits, see alignment E=4.7e-17 PF09278: MerR-DNA-bind" amino acids 45 to 110 (66 residues), 62.2 bits, see alignment E=8.8e-21

Best Hits

Swiss-Prot: 56% identical to SOXR_PSEAE: Redox-sensitive transcriptional activator SoxR (soxR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K13639, MerR family transcriptional regulator, redox-sensitive transcriptional activator SoxR (inferred from 99% identity to vco:VC0395_0056)

Predicted SEED Role

"Redox-sensitive transcriptional activator SoxR" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>CSW01_14440 redox-sensitive transcriptional activator SoxR (Vibrio cholerae E7946 ATCC 55056)
MEMTVGDVAQRAGVKVSALHFYEQKGLIHSWRNQGNQRRYDRSVLRRIAVIKAAQMVGLT
LEEIAEALAHLPKHEAPTRQDWQQMASHWHHFLDHRIQQLNALKEDLSGCIGCGCLSLES
CAIYNPKDIRAMTFADKTRLSHPEEWSR