Protein Info for CSW01_14370 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 19 to 271 (253 residues), 259.6 bits, see alignment E=1.7e-81 PF12849: PBP_like_2" amino acids 23 to 258 (236 residues), 160 bits, see alignment E=2.1e-50 PF13531: SBP_bac_11" amino acids 29 to 269 (241 residues), 39.1 bits, see alignment E=1.5e-13 PF01547: SBP_bac_1" amino acids 35 to 262 (228 residues), 31.3 bits, see alignment E=4.3e-11 PF12727: PBP_like" amino acids 44 to 213 (170 residues), 57.2 bits, see alignment E=2.6e-19

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to vcm:VCM66_A0067)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>CSW01_14370 phosphate ABC transporter substrate-binding protein (Vibrio cholerae E7946 ATCC 55056)
MKKTVIGAIALMGALAVTPVMAKETISAVGSSSVTPLMEVFSETYAKMNPEVFIEVQGPG
SSAGIKAAKNGSADIGMSSRNLKDSEKEATLVEEAIALDGIAVVVHPSNAVKGLTAEQVS
EIYKGEITNWKQVGGEDKPIVAITRDTASGTRGAFEDIMELKKKVADKEVSAISQRAQVA
NGNGALKTMVASNPYAIGYISLGTVDTSVHALAVNGVEASVDNVKNGTYKVSRPFLVLYK
QDKPSAEAKKFLDWMLSADAQKIVADKGYITVN