Protein Info for CSW01_14230 in Vibrio cholerae E7946 ATCC 55056

Annotation: serine/threonine transporter SstT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 68 (23 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details amino acids 323 to 350 (28 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details PF00375: SDF" amino acids 15 to 397 (383 residues), 223.8 bits, see alignment E=1.9e-70

Best Hits

Swiss-Prot: 100% identical to SSTT_VIBCH: Serine/threonine transporter SstT (sstT) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 100% identity to vcm:VCM66_A0035)

MetaCyc: 69% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium/dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>CSW01_14230 serine/threonine transporter SstT (Vibrio cholerae E7946 ATCC 55056)
MQNNSFLARLVRGNLVLQILAGILLGAAMATFSPEYAQKVGLIGNLFVGALKAVAPVLVF
ILVASSIANQKKNQHTYMRPIVVLYLFGTFSAALTAVILSFLFPTTLVLATGAEGATPPQ
GIAEVLNTLLFKLVDNPVSALMNANYIGILAWGVGLGLALHHSSSTTKAVFEDLSHGISQ
IVRFIIRLAPFGIFGLVASTFATTGFDALAGYAQLLAVLLGAMAFIALVVNPMIVYYKIR
RNPFPLVLQCLRESGVTAFFTRSSAANIPVNMALCEKLKLDEDTYSVSIPLGATINMAGA
AITITVLTLAAVHTMGIEVDLMTALLLSVVAAVSACGASGVAGGSLLLIPLACGLFGISN
DIAMQVVAVGFIIGVIQDSAETALNSSTDALFTAAVCQAEHEKRA