Protein Info for CSW01_14225 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphatidylglycerophosphatase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 57 to 74 (18 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details PF14378: PAP2_3" amino acids 58 to 227 (170 residues), 30 bits, see alignment E=4.6e-11 PF01569: PAP2" amino acids 86 to 234 (149 residues), 71.7 bits, see alignment E=5.1e-24

Best Hits

KEGG orthology group: K01096, phosphatidylglycerophosphatase B [EC: 3.1.3.27] (inferred from 100% identity to vch:VCA0035)

Predicted SEED Role

"Phosphatidylglycerophosphatase B (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.27

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>CSW01_14225 phosphatidylglycerophosphatase B (Vibrio cholerae E7946 ATCC 55056)
MKARIMSCKRALILLLTFVLLLIPLTLLSLQLDFTQPVSDSVGRVMTYLTHSAGKEGFLF
TLFFLVCWVGWRCHIPRHQWLNKSIQLMLLLGLAMVLKMGMKAVTQEPRPYTELMTQSLL
LPNAGHFYKLAQPKQEALMLAMEEKVSPWRVMHWQGETDFSFPSGHTVFAMVCLLYFGSL
LAEKKHYLSLGALLIWVSGVAYSRLWLGMHHPVDLLGAALLVGVLYLLVPQQYPLQHPRF
KPWLRRWHLV