Protein Info for CSW01_14170 in Vibrio cholerae E7946 ATCC 55056

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details PF03547: Mem_trans" amino acids 30 to 319 (290 residues), 66.5 bits, see alignment E=8.3e-23

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to vch:VCA0024)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>CSW01_14170 AEC family transporter (Vibrio cholerae E7946 ATCC 55056)
MQSLRAYIQGIDMTDIIAQLQFSATITGPICLMLGLGVLFKRINLINENFIEVASRIVFQ
VTLPAMLFLSIVSSKHDFSSSTSLVVYSLIANMLFFLFTLFSTRKLIDRPHDWGVITQGG
FRANTAIIGLAYVANTYGNAGVALAAIYVASTTVLFNIQAVIALTPRGESNGWQAGKLMF
KTLTKNPLIISIVLGFLCYLASVPIPKIVTDAGHYFANMTLPLALLCTGGSLNLNSLKDD
RHSAWFATGYKLILSPLLITGGAWLLGFRGLDLGLLFLMTSAPTAAASYVMARAMGGNAT
LAANIIALTTVFSLFTCTLGIFLLSSFGVI