Protein Info for CSW01_14090 in Vibrio cholerae E7946 ATCC 55056

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF01488: Shikimate_DH" amino acids 2 to 70 (69 residues), 39 bits, see alignment E=2.8e-13 PF02826: 2-Hacid_dh_C" amino acids 2 to 110 (109 residues), 34.2 bits, see alignment E=5.9e-12 PF03807: F420_oxidored" amino acids 2 to 67 (66 residues), 38.6 bits, see alignment E=4.7e-13 PF07991: KARI_N" amino acids 2 to 66 (65 residues), 23 bits, see alignment E=1.9e-08 PF03446: NAD_binding_2" amino acids 3 to 160 (158 residues), 180 bits, see alignment E=1.3e-56 PF14833: NAD_binding_11" amino acids 165 to 284 (120 residues), 104.5 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 53% identical to Y1503_SHEFN: Uncharacterized oxidoreductase Sfri_1503 (Sfri_1503) from Shewanella frigidimarina (strain NCIMB 400)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 99% identity to vcm:VCM66_A0007)

MetaCyc: 37% identical to tartronate semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
2-hydroxy-3-oxopropionate reductase. [EC: 1.1.1.60]

Predicted SEED Role

"3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.31 or 1.1.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>CSW01_14090 NAD(P)-dependent oxidoreductase (Vibrio cholerae E7946 ATCC 55056)
MRVSFIGLGVMGYPMAGHLQKAGFDVTVFNRTQAKAVAWAKQFGGQYAETVAECVKNADV
VLTCVGNDDDVRSMTTAATGAIPAMKPGAVLIDHTTTSALLAEELSAAAQQAGLHFMDAP
VSGGQAGAENGVLTIMCGGDEALFAKMQPIFAAYGRSSVLMGTAGQGQRAKMVNQICIAG
VLNGLSEGLMLAEQAGLDIPNLVACLKNGAAGSWQMENRALTMSQEKFDFGFAIDWMIKD
LGFCLDEAAQLGLRLPMTENTMTAYQRLSAQGLGRMDTSVLIQAVKEAAKK