Protein Info for CSW01_14050 in Vibrio cholerae E7946 ATCC 55056

Annotation: ribosomal RNA small subunit methyltransferase G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF02527: GidB" amino acids 23 to 204 (182 residues), 211.3 bits, see alignment E=7.6e-67 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 29 to 207 (179 residues), 190.8 bits, see alignment E=8.9e-61 PF13847: Methyltransf_31" amino acids 69 to 154 (86 residues), 28 bits, see alignment E=1.8e-10

Best Hits

Swiss-Prot: 100% identical to RSMG_VIBCH: Ribosomal RNA small subunit methyltransferase G (rsmG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 100% identity to vco:VC0395_A2518)

MetaCyc: 64% identical to 16S rRNA m7G527 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11578 [EC: 2.1.1.170]

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>CSW01_14050 ribosomal RNA small subunit methyltransferase G (Vibrio cholerae E7946 ATCC 55056)
MNPLRVKLDALISKTSLTVTEQQREQLVGYVQLLDKWNKAYNLTSVRDPMEMLVKHILDS
LVVSPHLVGERFIDVGSGPGLPGIPLAIMHPDKEFVLIDSLGKRIRFLKQVIHDLKINNV
LPVQSRVEEFDPESGFDGVLSRAFASMTDMVNWCQHLPKPNAGVFLALKGVRPDDEITLL
PEWCSVTDIKALQVPELEGERHLVILSRKG