Protein Info for CSW01_14035 in Vibrio cholerae E7946 ATCC 55056

Annotation: ATP synthase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details PF03899: ATP-synt_I" amino acids 15 to 111 (97 residues), 59.1 bits, see alignment E=2.5e-20

Best Hits

Swiss-Prot: 100% identical to ATPZ_VIBCH: ATP synthase protein I (atpI) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02116, ATP synthase protein I (inferred from 100% identity to vcj:VCD_001467)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>CSW01_14035 ATP synthase I (Vibrio cholerae E7946 ATCC 55056)
MVAVLARQGRELAKRLLLIQFSAVMVAAAVFAVAVNGDWGLSALVGGGIFVIANAVFAGC
AFLFAGARALKMVAISFYTGEALKILITIVLFSVAYMYMQLELVPLKLTYLLALGINICA
PVLFINNKK