Protein Info for CSW01_14025 in Vibrio cholerae E7946 ATCC 55056

Annotation: ATP synthase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00137: ATP-synt_C
  • amino acids 10 to 73 (64 residues), 48.1 bits, E=5.5e-17
• TIGR01260: ATP synthase F0, C subunit
  • amino acids 20 to 76 (57 residues), 101.8 bits, E=7.7e-34

Best Hits

Swiss-Prot: 100% identical to ATPL_VIBCH: ATP synthase subunit c (atpE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 98% identity to vvu:VV1_1016)

Predicted SEED Role

"ATP synthase F0 sector subunit c"

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (85 amino acids)

>CSW01_14025 ATP synthase subunit C (Vibrio cholerae E7946 ATCC 55056)
METVLSFSAIAVAIIVGLCAVGTAIGFAVLGGKFLEGAARQPEMAPMLQVKMFIIAGLLD
AVPMIGIVIALLFTFANPFVGQLAG