Protein Info for CSW01_14010 in Vibrio cholerae E7946 ATCC 55056

Annotation: ATP synthase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 TIGR00962: ATP synthase F1, alpha subunit" amino acids 2 to 512 (511 residues), 835.1 bits, see alignment E=9.9e-256 PF02874: ATP-synt_ab_N" amino acids 28 to 92 (65 residues), 47.2 bits, see alignment E=3.9e-16 PF00006: ATP-synt_ab" amino acids 149 to 375 (227 residues), 267.5 bits, see alignment E=1.3e-83 PF00306: ATP-synt_ab_C" amino acids 382 to 507 (126 residues), 148.7 bits, see alignment E=1.6e-47

Best Hits

Swiss-Prot: 100% identical to ATPA_VIBC3: ATP synthase subunit alpha (atpA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K02111, F-type H+-transporting ATPase subunit alpha [EC: 3.6.3.14] (inferred from 100% identity to vcj:VCD_001462)

MetaCyc: 85% identical to ATP synthase F1 complex subunit alpha (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase alpha chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>CSW01_14010 ATP synthase subunit alpha (Vibrio cholerae E7946 ATCC 55056)
MQLNSTEISDLIKQRIESFNVVSEARNEGTIVSVSDGIIRIHGLADVMQGEMIELPGNRY
ALALNLERDSVGAVVMGPYADLREGMKVTGTGRILEVPVGPELLGRVVNTLGEPIDGKGP
IGAKQTSPVEVIAPGVIDRKSVDQPVQTGYKSVDSMIPIGRGQRELIIGDRQTGKTALAI
DAIINQKNSGIYSIYVAIGQKASTIANVVRKLEEHGALKNTIVVVASASESAALQYLAPY
SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER
AARVNEEYVERFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF
NAGVRPAVDPGISVSRVGGAAQTKIVKKLSGGIRTALAAYRELAAFAQFSSDLDEATKRQ
LTHGQKVTELMKQKQYAPMSVFDQALVIFAAERGYLTDVELNKVLDFEAALLSYARAHYA
ELAAQIDKTGAYNDEIEAQLKKLVDDFKATQTW