Protein Info for CSW01_13955 in Vibrio cholerae E7946 ATCC 55056

Annotation: menaquinone-dependent protoporphyrinogen IX dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF12641: Flavodoxin_3" amino acids 4 to 86 (83 residues), 36.2 bits, see alignment E=5.5e-13 PF12724: Flavodoxin_5" amino acids 4 to 153 (150 residues), 169.5 bits, see alignment E=5.8e-54

Best Hits

Swiss-Prot: 46% identical to HEMG_ECOL6: Protoporphyrinogen IX dehydrogenase [menaquinone] (hemG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00230, protoporphyrinogen oxidase [EC: 1.3.3.4] (inferred from 100% identity to vcm:VCM66_2675)

MetaCyc: 46% identical to protoporphyrinogen oxidase (Escherichia coli K-12 substr. MG1655)
RXN-21483 [EC: 1.3.5.3]; 1.3.5.3 [EC: 1.3.5.3]

Predicted SEED Role

"Protoporphyrinogen IX oxidase, oxygen-independent, HemG (EC 1.3.-.-)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.-.- or 1.3.3.4 or 1.3.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>CSW01_13955 menaquinone-dependent protoporphyrinogen IX dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MKALLLYSSQEGQTRKIIERIAQQMPEYDCDIQDLHQVHEIALADYEKILIGASIRYGRL
NEKLYQFIQRHVTTLTNSKAAFFCVNLTARKEDQGKDTPEGSVYIQTFLKKSPWQPERIA
VFAGALYYPRYRWFDKMMIRLIMTLTGGETDTSKEVEYTNWEKVSQFGEQFRNW