Protein Info for CSW01_13870 in Vibrio cholerae E7946 ATCC 55056

Annotation: sensor domain-containing phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 849 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 349 to 368 (20 residues), see Phobius details PF22673: MCP-like_PDC_1" amino acids 146 to 230 (85 residues), 29.2 bits, see alignment E=2.2e-10 PF02743: dCache_1" amino acids 168 to 292 (125 residues), 50.9 bits, see alignment E=3.2e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 429 to 574 (146 residues), 73.5 bits, see alignment E=8.4e-25 PF00990: GGDEF" amino acids 429 to 574 (146 residues), 97.1 bits, see alignment E=1.9e-31 PF00563: EAL" amino acids 598 to 833 (236 residues), 237.7 bits, see alignment E=2.4e-74

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A2322)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (849 amino acids)

>CSW01_13870 sensor domain-containing phosphodiesterase (Vibrio cholerae E7946 ATCC 55056)
MRLEKGMPLKRQIRLKTAIILPFVLTFLFMILAMAAVQTYRYEQTVKELSSKKLSYLTDS
ISQRLSDFLNRPFFANQMIAYNVGFHHLYQLNDVSRIEDFIRAAANPIGNNIQQIDVVGF
GGVNGEYVGLRRDAPEQYSLMLKDARTDDKLVIYQTATKNDQLRTVIDNYDPRVRPWFAP
VAQKPSPQWSSVYTNMDEKQEITLSALSPVFQDKRFIGVMVSDVKLNTFNQFLSELKQRM
NADVYVMDKQHRLIAHSGEGSVVSWGTPLSPKGERLFASENRNPIIRSSAEQLDLQGLNV
GTFTTYVNQQRYFNQASAFTDQYGLTWYISVSIAEGDLLGSLPENQKTSWAIGLLVSLVG
LGLGLMALNRVANPIISTASAARQLANGDWTASMPKPGKIYETSLLVQAFIEMTNSLKAS
FKALRSQLVYDSLTQLLSREGLVEHCHQIPQLNGGLILIGIDKFRDINDSLGHHQADQLL
VAIAQRLKVTFPEPALIARIGGDEFAIYLPDVNQQDDLKSVATDILKLFASPFSMPSDNI
AVNVSIGIVYLEEPNMTVWLRNGSIALSNAKAEHTHISFYSPEMANASRKRMLMVTQIKL
ALDNQEFVPFYQPIVDLNSGEVLGAEALARWISPEFGLIPPMDFIPIAEESGLINAIGEQ
ILRQACADTVRGIAENKWPSTFHMHVNLSVNQLSHPDFIAQLHSVLDESGLQPTNLTLEI
TESRIVDNDPVILHNMLELKKARIHIAIDDFGTGYSSLAYLHKLPFDCLKIDREFVSQLN
AYNIENSVVAAIVNMTRGFKVELVAEGIETQEQVDLLNQLGCPRGQGFLFSKPMAYQDWP
TDLVNMKQS