Protein Info for CSW01_13820 in Vibrio cholerae E7946 ATCC 55056

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 204 to 224 (21 residues), see Phobius details PF00583: Acetyltransf_1" amino acids 21 to 124 (104 residues), 40.5 bits, see alignment E=6.1e-14 PF13508: Acetyltransf_7" amino acids 56 to 125 (70 residues), 34.9 bits, see alignment E=3.2e-12 PF13673: Acetyltransf_10" amino acids 68 to 146 (79 residues), 36.1 bits, see alignment E=1.2e-12 PF09500: YiiD_C" amino acids 159 to 298 (140 residues), 179.7 bits, see alignment E=6.1e-57 TIGR02447: putative thioesterase domain" amino acids 166 to 298 (133 residues), 145.7 bits, see alignment E=4.1e-47

Best Hits

Swiss-Prot: 50% identical to YIID_ECOL6: Uncharacterized protein YiiD (yiiD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_001628)

Predicted SEED Role

"GNAT family acetyltransferase YiiD potentially involved in tRNA processing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>CSW01_13820 GNAT family N-acetyltransferase (Vibrio cholerae E7946 ATCC 55056)
MSMFKLITPTTDNQLNKYFHFRWQMLREPWRMPIGSERDEYDSMSHHRMIVDSRGYPMAI
GRLYITPDCEGQIRYMAVKANRRSKGMGSLILVALESLARQEGAKRLVCNAREDAIPFYA
KNGFERRGELTDERGPVRHQQMVKTLDPMANVLRKPEWCTELQDRWGKHIPISDKMGIKI
QQYTGYQFQCCAQLNPNLNPHNTLFAGSAFTLATLTGWGMAWLLMRERDLQGDIVLVDSH
IRYRHPVVQNPVASTSLDGISGDLDRLESGRKARIVVRVIISSGEVEAIEFIGTYMLIPN
YKALVAQKSS