Protein Info for CSW01_13765 in Vibrio cholerae E7946 ATCC 55056

Annotation: type II secretion system protein GspI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07963: N_methyl
  • amino acids 1 to 26 (26 residues), 34.3 bits, 1.2e-12
• TIGR02532: prepilin-type N-terminal cleavage/methylation domain
  • amino acids 4 to 24 (21 residues), 29.8 bits, 3.7e-11
• TIGR01707: type II secretion system protein I
  • amino acids 6 to 103 (98 residues), 143.9 bits, E=2e-46
• PF02501: T2SSI
  • amino acids 40 to 116 (77 residues), 80.9 bits, E=5.9e-27

Best Hits

Swiss-Prot: 100% identical to GSPI_VIBCH: Type II secretion system protein I (epsI) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02458, general secretion pathway protein I (inferred from 100% identity to vco:VC0395_A2301)

Predicted SEED Role

"General secretion pathway protein I"

Protein Sequence (117 amino acids)

>CSW01_13765 type II secretion system protein GspI (Vibrio cholerae E7946 ATCC 55056)
MKSKRGFTLLEVLVALAIFATAAISVIRSVSQHINTVNYLEEKMFAAMVVDNQMAQVMLN
PQSLAAREGSEQMAGRTWYWKLSPVKTADNLLKAFDVSVATEKGATPVVTVRSYVAN