Protein Info for CSW01_13750 in Vibrio cholerae E7946 ATCC 55056

Annotation: type II secretion system protein GspL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 254 to 275 (22 residues), see Phobius details TIGR01709: type II secretion system protein L" amino acids 9 to 406 (398 residues), 420.5 bits, see alignment E=3.6e-130 PF05134: T2SSL" amino acids 9 to 244 (236 residues), 300.6 bits, see alignment E=6.7e-94 PF12693: GspL_C" amino acids 250 to 406 (157 residues), 175.3 bits, see alignment E=9.1e-56

Best Hits

Swiss-Prot: 100% identical to GSPL_VIBCH: Type II secretion system protein L (epsL) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 100% identity to vcm:VCM66_2645)

Predicted SEED Role

"General secretion pathway protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>CSW01_13750 type II secretion system protein GspL (Vibrio cholerae E7946 ATCC 55056)
MEGSVSEFLTVRLSSQKEADIPWLVWSAEQQEVIASGQVAGWEALHEIESYADQRSVVVL
LAASDLILTSVEIPPGASRQLENMLPYLLEDEIAQDVEDVHFCVLSKGRETADVVGVDRL
WLRACLDHLKACGFDVKRVLPDVLAIPRPEHGLAALQLGDEWLVRKSTTQGMAVDAQWLS
LLAASDWVQNEGEYLPLQALTPLPELSLAETQEWRYEPSGLVMQLLTQEALTSKFNLLTG
SFKLKSSWLRYWQIWRKVAIAAGLFVAVSISYSLFQAHQYEAQADAYRAESERIFRSIFP
DKQKIPTVTYLKRQMSDEMARLSGGASVGSVLKWLSPLPEALKGVNLQLQSIKFDSNRSE
IRLEATSRDFQSFEQARTQLEQYFAVEQGQLNKNGEQVFGVFVVKPK