Protein Info for CSW01_13730 in Vibrio cholerae E7946 ATCC 55056

Annotation: ADP compounds hydrolase NudE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF00293: NUDIX" amino acids 47 to 155 (109 residues), 60.8 bits, see alignment E=1.5e-20 PF22327: Nudt16-like" amino acids 74 to 138 (65 residues), 27.1 bits, see alignment E=3.7e-10

Best Hits

Swiss-Prot: 64% identical to NUDE_ECOLI: ADP compounds hydrolase NudE (nudE) from Escherichia coli (strain K12)

KEGG orthology group: K08312, ADP-ribose diphosphatase [EC: 3.6.1.-] (inferred from 100% identity to vco:VC0395_A2294)

MetaCyc: 64% identical to ADP-sugar diphosphatase NudE (Escherichia coli K-12 substr. MG1655)
ADP-sugar diphosphatase. [EC: 3.6.1.21]

Predicted SEED Role

"ADP compounds hydrolase NudE (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>CSW01_13730 ADP compounds hydrolase NudE (Vibrio cholerae E7946 ATCC 55056)
MSSKSLPEILDRETVAKSRLFTIEALDLRFSNGEQRTYERMKPSGRHAVMMVPITAQGDL
LLVREYAAGTERYELGFPKGLVDHGETAEQAANRELKEEIGFGARQLTPLKEVVLAPSYF
SSKMVLFVAQDLYSEQLEGDEPEPLEIIRWPLAQAEDLLTHLDFCEARSITALLLALRFL
QA