Protein Info for CSW01_13725 in Vibrio cholerae E7946 ATCC 55056

Annotation: Fe-S biogenesis protein NfuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 TIGR03341: IscR-regulated protein YhgI" amino acids 5 to 195 (191 residues), 314.4 bits, see alignment E=1.3e-98 PF01521: Fe-S_biosyn" amino acids 5 to 102 (98 residues), 49.9 bits, see alignment E=3.3e-17 PF01106: NifU" amino acids 114 to 175 (62 residues), 64.3 bits, see alignment E=9.1e-22

Best Hits

Swiss-Prot: 100% identical to NFUA_VIBCH: Fe/S biogenesis protein NfuA (nfuA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07400, Fe/S biogenesis protein NfuA (inferred from 100% identity to vco:VC0395_A2293)

MetaCyc: 75% identical to iron-sulfur cluster carrier protein NfuA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NfuA Fe-S protein maturation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>CSW01_13725 Fe-S biogenesis protein NfuA (Vibrio cholerae E7946 ATCC 55056)
MSNPITITESAQSHFAKLLAQQPEGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEYP
FSGFSAYVDELSLPFLEEAVIDFVTDKMGSQLTLKAPNAKMRKVSDDASLMERVEYALQT
QVNPQLAGHGGHVRLISISDDGVALVQFGGGCNGCSMVDVTLKEGIEKELLAQFAGELTA
VRDSTEHDRGEHSYY