Protein Info for CSW01_13715 in Vibrio cholerae E7946 ATCC 55056

Annotation: pimeloyl-[acyl-carrier protein] methyl ester esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 TIGR01738: pimelyl-[acyl-carrier protein] methyl ester esterase" amino acids 24 to 266 (243 residues), 399.3 bits, see alignment E=3.5e-124 PF12697: Abhydrolase_6" amino acids 29 to 259 (231 residues), 76.7 bits, see alignment E=1.3e-24 PF00975: Thioesterase" amino acids 29 to 209 (181 residues), 36.5 bits, see alignment E=1.9e-12 PF12146: Hydrolase_4" amino acids 29 to 243 (215 residues), 47 bits, see alignment E=6.5e-16 PF00561: Abhydrolase_1" amino acids 29 to 254 (226 residues), 107.1 bits, see alignment E=3.7e-34

Best Hits

Swiss-Prot: 100% identical to BIOH_VIBCH: Pimeloyl-[acyl-carrier protein] methyl ester esterase (bioH) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02170, biotin biosynthesis protein BioH (inferred from 100% identity to vch:VC2718)

MetaCyc: 53% identical to pimeloyl-acyl carrier protein methyl ester esterase (Escherichia coli K-12 substr. MG1655)
RXN-11483 [EC: 3.1.1.85]; Carboxylesterase. [EC: 3.1.1.85, 3.1.1.1]

Predicted SEED Role

"Biotin synthesis protein BioH"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1 or 3.1.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>CSW01_13715 pimeloyl-[acyl-carrier protein] methyl ester esterase (Vibrio cholerae E7946 ATCC 55056)
MAEWMKMEIDGETVTMALYWQVSGQGQDLVLVHGWGMNGAVWQQTAQALSDHFRVHVVDL
PGYGHSAEQHAASLEEIAQALLEHAPRNAIWVGWSLGGLVATHMALHHSDYVSKLVTVAS
SPKFAAQGSWRGIQPDVLTAFTDQLVADFQLTIERFMALQAMGSPSARQDVKVLKQAVLS
RPMPNPQSLLAGLTMLAEVDLRDELQHISVPMLRLYGRLDGLVPAKVARDLNHLAPYSEA
FMFDQSSHAPFMTEAEAFCQQLIEFATR