Protein Info for CSW01_13695 in Vibrio cholerae E7946 ATCC 55056

Annotation: two-component system response regulator OmpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00072: Response_reg" amino acids 7 to 117 (111 residues), 106.5 bits, see alignment E=8.7e-35 PF00486: Trans_reg_C" amino acids 157 to 232 (76 residues), 79.8 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 83% identical to OMPR_ECOL6: Transcriptional regulatory protein OmpR (ompR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07659, two-component system, OmpR family, phosphate regulon response regulator OmpR (inferred from 100% identity to vco:VC0395_A2286)

Predicted SEED Role

"Two-component system response regulator OmpR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>CSW01_13695 two-component system response regulator OmpR (Vibrio cholerae E7946 ATCC 55056)
MVENHKVLVVDDDARLRALLERYLSEQGFQVRSVANGEQMDRLLTRENFHLMVLDLMLPG
EDGLSICRRLRNSNNMIPILMLTAKGDEIDRIVGLEVGADDYLPKPFNPRELLARIKAVL
RRQVIEAPGAPSAEETIIEFGEFRLNLGTREMFRGEEAMPLTSGEFAVLKALVTNAREPL
SRDKLMNMARGREYSAMERSIDVQISRLRRMLEVDPSKPRYIQTVWGLGYVFVPDGKAAN