Protein Info for CSW01_13685 in Vibrio cholerae E7946 ATCC 55056

Annotation: xanthine permease XanP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 37 to 63 (27 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 350 to 373 (24 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details amino acids 436 to 458 (23 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 30 to 457 (428 residues), 422.3 bits, see alignment E=2.1e-130 PF00860: Xan_ur_permease" amino acids 35 to 427 (393 residues), 331.6 bits, see alignment E=2.8e-103 TIGR03173: xanthine permease" amino acids 40 to 459 (420 residues), 435.2 bits, see alignment E=2.1e-134

Best Hits

Swiss-Prot: 68% identical to XANP_ECOL6: Xanthine permease XanP (xanP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 100% identity to vcm:VCM66_2632)

MetaCyc: 68% identical to xanthine:H+ symporter XanP (Escherichia coli K-12 substr. MG1655)
RXN-5076

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>CSW01_13685 xanthine permease XanP (Vibrio cholerae E7946 ATCC 55056)
MRKVLLTIRKIAMTQPTSRKADLVYQLNDRPPLPQTLFAALQHLLAMFVAVITPSLIICQ
SLGVPADQTNTIISMSLFASGLSSFIQIRTFGPIGSGLLSIQGTSFNFLGPIIGAGLALK
AGGADIETMMAAIFGTILVASSAEILLSRVLQFAQRIITPLVSGIVVTLIGLTLVQVGLI
SMGGGYAAMADGSFGSLDKLALAGTVLAIIVLLNRAHNPYVRVASIVIAMLVGYVMAYLM
GMVNTDNLAETQFIALPIPMQYGLGFDWSLFIPLVLIFLITALEAIGDITATSEVSGEPV
KGPVYMKRIKGGVLADGLNSALAAVFNSFPNSTFSQNNGVILLTGVASRYVGYFIAGMLV
LLGLFPGVASFVQLIPEPVLGGATIVMFGTIAAAGVRIISRVDLDRRAILIMALSFSMGL
GIAQKPEILQFMPEFIKNLFSSGVAAGGITAIVLNLLLPEVRRDEDAASVAKTEAAQESN