Protein Info for CSW01_13655 in Vibrio cholerae E7946 ATCC 55056

Annotation: cation acetate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 377 to 404 (28 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details amino acids 449 to 474 (26 residues), see Phobius details amino acids 481 to 501 (21 residues), see Phobius details amino acids 515 to 537 (23 residues), see Phobius details TIGR03648: probable sodium:solute symporter, VC_2705 subfamily" amino acids 8 to 558 (551 residues), 870.3 bits, see alignment E=2.5e-266 PF00474: SSF" amino acids 33 to 302 (270 residues), 114.8 bits, see alignment E=2.3e-37 amino acids 373 to 489 (117 residues), 65.2 bits, see alignment E=2.7e-22

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 100% identity to vco:VC0395_A2278)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (567 amino acids)

>CSW01_13655 cation acetate symporter (Vibrio cholerae E7946 ATCC 55056)
MDIQTWTFILVGITFALYIGIAIWARAGSTSEFYVAGGGVHPVANGMATAADWMSAASFI
SMAGIISFIGYDGTVYLMGWTGGYVLLALCLAPYLRKFGKFTVPDFIGDRYYSRTARMVA
VFCAIFISFTYVAGQMRGVGVVFARFLEVDINVGIVIGMAIVFFYAVMGGMKGITYTQVA
QYCVLIFAFLVPAIFTSLMMTGNPIPQIGFGSTLTGTDDYLLNKLDGLAVELGFTAYTDG
SKSMVDVFFICAALMVGTAGLPHVIIRFFTVPKVSDARVSAGWALVFIAFLYTTAPAVAA
FARVNMIDTINGPDMQGVTAAEAPTWYRNWESTGLVKWEDKNGDGRMFYSGDARNEMTIN
NDIIVLASPEIAKLPNWVVALLAAGGLAAALSTAAGLLLVISTAISHDLLKKGFKPDMTD
KQELLAARIAAALAIVGAGYLGINPPGFVAQVVAFAFGLAAASFFPAIILGIFYKKMNKE
GAIIGMLAGITFTAAYIIYFKFINPAASVPANWWFGISPEGIGTLGMCLNFVVAIVVNKF
TAEVPQDVQDMVESIRYPKGAGAAHSH