Protein Info for CSW01_13610 in Vibrio cholerae E7946 ATCC 55056

Annotation: membrane protein FxsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 76 to 101 (26 residues), see Phobius details PF04186: FxsA" amino acids 8 to 114 (107 residues), 128 bits, see alignment E=8.6e-42

Best Hits

KEGG orthology group: K07113, UPF0716 protein FxsA (inferred from 100% identity to vcj:VCD_001672)

Predicted SEED Role

"FxsA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>CSW01_13610 membrane protein FxsA (Vibrio cholerae E7946 ATCC 55056)
MFPILLFLFIAVPVIEIALFIQVGGVLGVWPTIALVLLTAIVGASLVRSQGLQTLLTVQQ
RLAQGQLPAQQILEGVMLAVAGVLLLTPGFFTDILGMLVLLPAPRAYFAKQLMSRVVVGN
IHASGAGFEQPNPFHDRANPNGTTYEGEFERKDDQDQHRLK