Protein Info for CSW01_13605 in Vibrio cholerae E7946 ATCC 55056

Annotation: tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00185: tRNA (cytidine(34)-2'-O)-methyltransferase" amino acids 1 to 156 (156 residues), 193.5 bits, see alignment E=1e-61 PF00588: SpoU_methylase" amino acids 3 to 145 (143 residues), 121.2 bits, see alignment E=1.9e-39

Best Hits

Swiss-Prot: 67% identical to TRML_SHEPW: tRNA (cytidine(34)-2'-O)-methyltransferase (trmL) from Shewanella piezotolerans (strain WP3 / JCM 13877)

KEGG orthology group: K03216, RNA methyltransferase, TrmH family, group 2 [EC: 2.1.1.-] (inferred from 100% identity to vco:VC0395_A2267)

Predicted SEED Role

"tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207)" (EC 2.1.1.207)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.207

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>CSW01_13605 tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL (Vibrio cholerae E7946 ATCC 55056)
MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRH
KDYAAFIEYLQRERGSFRLFACTTKTTQHHVDAQFQQGDVLLFGPETRGLPAELIASLPA
EQRIRIPMMPEARSLNLSNAVAIIAFEAWRQMGFDGAR